Henan Tianfu Chemical Co., Ltd.

Pharmaceutical Agrochemicals Food Additives Synthetic Flavours & Fragrances Plant Extract Adhesive and Sealant Catalyst and Auxiliary Dyestuff and Pigment Materials Basic Inorganic Chemicals Organic Chemicals Others Reagent

Henan Tianfu Chemical Co., Ltd.

Country: China (Mainland)Business Type: Lab/Research institutions

Manufacturer

Assessed supplierAssessed
supplier

qq

    x
  • Mr.Nolan
  • Ms. Jane Kong

Contact US
Mr.Anson
Tel: 86-371-55170693/55170694
Ms.Fan Cindy
Tel: +86 0371 5517 0693
Mr.Richard Ran
Tel: 86 371 55170693
Ms.Anna
Tel: +86 -371 5517 0693
Mr.Nolan
Tel: 0371-55170695
Mr.Jeff Pei
Tel: 0371-55170693
Ms.Alice
Tel: :+86-371-5517 0693
Mr.Anson
Tel: 0371-55170693-8638
Ms.Monica Xie
Tel: 86 0371 5517 0693(147)
Ms.Cherry Zhang
Tel: 0086-371-55170690
Ms.Daisy He
Tel: 371-55170693
  • Fax: 86-371-55170690
  • URL: http://www.tianfuchem.com
  • Province/state: Henan
  • City: Zhengzhou
  • Street:Zhengzhou International Trade New Territory,Jinshui District,Zhengzhou ,China
  • MaxCard:
Home > Products > 

High purity CAS 57014-02-5 Calcitonin eel

High purity CAS 57014-02-5 Calcitonin eel CAS NO.57014-02-5

  • FOB Price: USD: 100.00-100.00 /Kilogram Get Latest Price
  • Min.Order: 1 Gram
  • Payment Terms: L/C,T/T
  • Available Specifications:

    1(1-100)Kilogram

  • Product Details

Keywords

  • 57014-02-5
  • Calcitonin eel
  • C146H241N43O47S2

Quick Details

  • ProName: High purity CAS 57014-02-5 Calcitonin ...
  • CasNo: 57014-02-5
  • Molecular Formula: C146H241N43O47S2
  • Appearance: White powder
  • Application: API,Pharmaceutical intermediates
  • DeliveryTime: In Stock
  • PackAge: 25KGS/Drum
  • Port: China Main Port
  • ProductionCapacity: 1000 Metric Ton/Day
  • Purity: 99%
  • Storage: Room temperature
  • Transportation: BY SEA
  • LimitNum: 1 Gram
  • Heavy metal: N/A
  • Grade: Industrial Grade,Food Grade
  • Transportation: N/A

Superiority

High purity CAS 131-54-4 2,2'-Dihydroxy-4,4'-dimethoxybenzophenone in stock

Our main business covers the fields below:
 
1.Noble Metal Catalysts (Pt.Pd...)
2.Organic Phosphine Ligands (Tert-butyl-phosphine.Cyclohexyl-phosphine...)
3.OLED intermediates (Fluorene,Carbazole,Boric acid...)
4.Pharmaceutical intermediates 
 
 About us
1.More than 10 years chemical exporting experience 
We have produced chemical more than fifteen years., 80% products are for export .
More than 10 years chemical exporting experience. Good and stabilized factory price.
2.Strict quality control system
3.Supply sample
Before order , we can send the sample for your testing . We ensure the quality is the same as bulk quantity .
 
 Our advantage:
Q1:Can I get the free sample
A: Yes, we can supply the free sample, but the shipping cost be paid by our customers.
 
Q2: How to start orders or make payments
A: Proforma invoice will be sent first after confirmation of order, enclosed our bank information.
Payment by T/T, or Paypal or L/C.
 
Q3: How to confirm the Product Quality before placing orders
A:You can get free samples for some products,you only need to pay the shipping cost or arrange a courier to us and take the samples.
You can send us your product specifications and requests,we will manufacture the products according to your requests.
 
Q4:What’s your MOQ
A:Usually according you demand.
 
Q5: How about delivery leadtime
A:Delivery lead time: As soon as possible. (Chinese holiday not included)
 
Q6:Is there a discount
A:Different quantity has different discount.
 
Q7: How to contact us
A:You can chat with us by Trademanager,Email,WhatsAPP,Wechat.
You can choose your interested products and send inquiry to us.
You can dial our telephone directly, you will get our reply.

Details

Calcitonin eel Basic information
Product Name: Calcitonin eel
Synonyms: THYROCALCITONIN EEL;CALCITONIN, EEL;CSNLSTCVLGKLSQELHKLQTYPRTDVGAGTP-NH2;CSNLSTCVLGKLSQELHKLQTYPRTDVGAGTP-NH2 (DISULFIDE BRIDGE: 1-7);H-CYS-SER-ASN-LEU-SER-THR-CYS-VAL-LEU-GLY-LYS-LEU-SER-GLN-GLU-LEU-HIS-LYS-LEU-GLN-THR-TYR-PRO-ARG-THR-ASP-VAL-GLY-ALA-GLY-THR-PRO-NH2;H-CYS-SER-ASN-LEU-SER-THR-CYS-VAL-LEU-GLY-LYS-LEU-SER-GLN-GLU-LEU-HIS-LYS-LEU-GLN-THR-TYR-PRO-ARG-THR-ASP-VAL-GLY-ALA-GLY-THR-PRO-NH2 (DISULFIDE BRIDGE: 1-7);cys-ser-asn-leu-ser-thr-cys-val-leu-gly-lys-leu-ser-gln-glu-leu-his-lys-leu-gln-thr-tyr-pro-arg-thr-asp-val-gly-ala-gly-thr-pro-nh2 [disulfide bridge: 1-7];miacalcic
CAS: 57014-02-5
MF: C146H241N43O47S2
MW: 3414.87
EINECS: 232-693-2
Product Categories: TPI;Peptide
Mol File: 57014-02-5.mol
 
Packing:
About us
1.More than 10 years chemical exporting experience 
We have produced chemical more than fifteen years., 80% products are for export .
More than 10 years chemical exporting experience. Good and stabilized factory price.
2.Strict quality control system
3.Supply sample
Before order , we can send the sample for your testing . We ensure the quality is the same as bulk quantity .
 
Delivery:
 
 Our advantage:
Q1:Can I get the free sample
A: Yes, we can supply the free sample, but the shipping cost be paid by our customers.
 
Q2: How to start orders or make payments
A: Proforma invoice will be sent first after confirmation of order, enclosed our bank information.
Payment by T/T, or Paypal or L/C.
 
Q3: How to confirm the Product Quality before placing orders
A:You can get free samples for some products,you only need to pay the shipping cost or arrange a courier to us and take the samples.
You can send us your product specifications and requests,we will manufacture the products according to your requests.
 
Q4:What’s your MOQ
A:Usually according you demand.
 
Q5: How about delivery leadtime
A:Delivery lead time: As soon as possible. (Chinese holiday not included)
 
Q6:Is there a discount
A:Different quantity has different discount.
 
Q7: How to contact us
A:You can chat with us by Trademanager,Email,WhatsAPP,Wechat.
You can choose your interested products and send inquiry to us.
You can dial our telephone directly, you will get our reply.
 
Our Factory
 

Other products of this supplier