Henan Tianfu Chemical Co., Ltd.

Pharmaceutical Agrochemicals Food Additives Synthetic Flavours & Fragrances Plant Extract Adhesive and Sealant Catalyst and Auxiliary Dyestuff and Pigment Materials Basic Inorganic Chemicals Organic Chemicals Others Reagent

Henan Tianfu Chemical Co., Ltd.

Country: China (Mainland)Business Type: Lab/Research institutions

Manufacturer

Assessed supplierAssessed
supplier

qq

    x
  • Mr.Nolan
  • Ms. Jane Kong

Contact US
Mr.Anson
Tel: 86-371-55170693/55170694
Mr.Vincent
Tel: +86 0371 5517 0693
Mr.Richard Ran
Tel: 86 371 55170693
Ms.Anna
Tel: +86 -371 5517 0693
Mr.Nolan
Tel: 0371-55170695
Mr.Jeff Pei
Tel: 0371-55170693
Ms.Leona
Tel: :+86-371-5517 0693
Mr.Brant Miao
Tel: 0371-55170693-8638
Mr.Patric
Tel: 0086-371-55170690
  • Fax: 86-371-55170690
  • URL: http://www.tianfu-chem.com/
  • Province/state: Henan
  • City: Zhengzhou
  • Street:Zhengzhou International Trade New Territory,Jinshui District,Zhengzhou ,China
Home > Products > 

TIANFU-CHEM Teriparatide acetate

TIANFU-CHEM Teriparatide acetate CAS NO.52232-67-4

  • Min.Order: 1 Gram
  • Payment Terms: L/C,D/A,D/P,T/T,Western Union,MoneyGram,Other
  • Product Details

Keywords

  • 52232-67-4
  • Teriparatide acetate
  • Teriparatide acetate

Quick Details

  • ProName: TIANFU-CHEM Teriparatide acetate
  • CasNo: 52232-67-4
  • Molecular Formula: C172H278N52O47S2
  • Appearance: white to light yellow crystal powder
  • Application: for organic synthesis use
  • DeliveryTime: As your quantity
  • PackAge: as per buyers
  • Port: China main port
  • ProductionCapacity: 10 Kilogram/Month
  • Purity: 99%
  • Storage: room temperature
  • Transportation: By sea , by air or express
  • LimitNum: 1 Gram
  • Heavy metal: N/A
  • Grade: Industrial Grade,Food Grade,Pharma Gra...
  • Transporttation: N/A

Superiority


our advantage:our company was built in 2009 with an iso certificate.in the past 5 years, we have grown up as a famous fine chemicals supplier in china and we had established stable business relationships with samsung,lg,merck,thermo fisher scientific and so on.our main business covers the fields below:
1.noble metal catalysts (pt.pd...)
2.organic phosphine ligands (tert-butyl-phosphine.cyclohexyl-phosphine...)
3.oled intermediates (fluorene,carbazole,boric acid...)
4.customs synthesis
1. higest quality and good package
2.better payment term
4.fast response to customer within 6 hours
5.good business credit in europe ,us ,japan ,korea

3.fast delivery
anyway ,if you need any chemicals from china ,henan tianfu can help you

Details

Teriparatide acetate Basic information
Product Name: Teriparatide acetate
Synonyms: PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);TERIPARATIDE;Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
CAS: 52232-67-4
MF: C172H278N52O47S2
MW: 3890.49792
EINECS:  
Product Categories: Amino Acid Derivatives;Peptide;Hormones;Other Protein/Peptide Hormones;Parathyroid Hormone (PTH)Peptides and Proteins;Parathyroid Hormone Fragments;Peptides for Cell Biology;Peptides and Proteins;Various Peptides;EndocrinologyandHormones;proteins
Mol File: 52232-67-4.mol
Teriparatide acetate Structure
 
Teriparatide acetate Chemical Properties
storage temp.  −20°C
form  powder

 

Other products of this supplier